DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k10201 and znf511

DIOPT Version :9

Sequence 1:NP_788296.1 Gene:l(2)k10201 / 48373 FlyBaseID:FBgn0016970 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_002940354.2 Gene:znf511 / 100380156 XenbaseID:XB-GENE-958453 Length:261 Species:Xenopus tropicalis


Alignment Length:224 Identity:56/224 - (25%)
Similarity:89/224 - (39%) Gaps:61/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSREQIIR-ILSEVPAGFIKPTDPPAPSLAPFKKLGVLVDIDDILGEQDAAAARIRDNIDK-EQS 73
            |||...|| :|:.:  |.:|.|          .||.:...       |.|..:.:.|.::. |..
 Frog    55 LSRHFYIRDVLTSI--GKVKET----------SKLSLFCC-------QTAGCSHVFDTLESYEHH 100

  Fly    74 YS------CVECRKMLPTAHLLDLHITEQHDCYFAASVERGDKPMFSCFLEECTIKFHTARQRKD 132
            |:      |..|:...|||.|||:||.|.|:..|.....:|:  |:.|.:|.|...|..:.:|::
 Frog   101 YNTMHRNVCTTCKHFFPTARLLDIHIFECHNSIFEIMAGKGN--MYQCLVEGCAENFKNSMEREN 163

  Fly   133 HCIITHKLPANYRFDHSKNRGKQKHQG--KSKPNSMEV----DEVIE------------ETKSLP 179
            |.:..|..|:::.||.:|....:.:|.  ..|..||::    |..:|            .::|||
 Frog   164 HLVTMHLYPSDFHFDKTKKSRSKNNQNLISRKDASMDIVTGEDSCVESMEIGVVRFEDKSSESLP 228

  Fly   180 YVK--------------AFSFGHQTQRSF 194
            ..|              ...||....|.|
 Frog   229 PTKIPSTCLHTKYRIPSTICFGQGAVRGF 257



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9863
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5180
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1360267at2759
OrthoFinder 1 1.000 - - FOG0007118
OrthoInspector 1 1.000 - - oto103625
Panther 1 1.100 - - LDO PTHR21354
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.