DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NNMT and Dh44-R1

DIOPT Version :9

Sequence 1:	NP_001358974.1	Gene:	NNMT / 4837	HGNCID:	7861	Length:	264	Species:	Homo sapiens
Sequence 2:	NP_610960.1	Gene:	Dh44-R1 / 36601	FlyBaseID:	FBgn0033932	Length:	504	Species:	Drosophila melanogaster

Alignment Length:	70	Identity:	18/70 - (25%)
Similarity:	32/70 - (45%)	Gaps:	7/70 - (10%)

- Green bases have known domain annotations that are detailed below.

Human    40 HLLKNLFKIFCLDGVKGDLLIDIG-SGPTIYQLLSACESFKEIVVTDYSDQNLQELE-KWLKKEP 102
            :|...:.|.|..|.::.::...|| .||.::.:..|..  |.:.|| ||.....|:. .|:::
  Fly   220 YLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVA--KSLTVT-YSTPEKYEINCPWMQE-- 279

Human   103 EAFDW 107
            ...||
  Fly   280 THVDW 284

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NNMT	NP_001358974.1	NNMT_PNMT_TEMT	2..259	CDD:366529	18/70 (26%)
		S-adenosyl-L-methionine binding. /evidence=ECO:0000269\|Ref.8	63..64		1/1 (100%)
		S-adenosyl-L-methionine binding. /evidence=ECO:0000269\|Ref.8	142..143
Dh44-R1	NP_610960.1	HRM	52..112	CDD:397086
		7tmB1_DH_R	126..394	CDD:320391	18/70 (26%)
		TM helix 1	129..153	CDD:320391
		TM helix 2	162..183	CDD:320391
		TM helix 3	197..219	CDD:320391
		TM helix 4	238..254	CDD:320391	4/15 (27%)
		TM helix 5	279..302	CDD:320391	2/8 (25%)
		TM helix 6	327..349	CDD:320391
		TM helix 7	356..381	CDD:320391
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4564
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900