DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:253 Identity:95/253 - (37%)
Similarity:123/253 - (48%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLP-QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67
            |..|.:|||           || ..|.:||||......|.|:|:||....||.||||:.|...::
Mouse     7 FTFLGAAVA-----------LPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVL 60

  Fly    68 TAAHCLQSVSASVLQIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            :||||.:    ..||:|.|.....  .||..| .......|..||.:|:.|||.:||:......:
Mouse    61 SAAHCYK----RRLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILN 121

  Fly   130 STIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193
            |.:..:.|..|..:..|...||||| |:|.| ...|:.||.:...::|.|.|..|   |..||.|
Mouse   122 SQVSTVSLPRSCASTNAQCLVSGWGNTVSIG-GKYPALLQCLEAPVLSASSCKKS---YPGQITS 182

  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .|.|..  ..|||:|.||||||:|..|.:.|:||||..||....||||..|....||:
Mouse   183 NMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 86/224 (38%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 86/224 (38%)
Tryp_SPc 24..243 CDD:238113 87/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.