DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and prss1

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:256 Identity:103/256 - (40%)
Similarity:145/256 - (56%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :|..|||:..|.|....:.:.     |.:||||...|.:..|:|:|| .||.|.||||:.|:..:
Zfish     1 MKAFILLALFAVAYAAPLGDD-----DDKIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWV 59

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKN------HEGYNANTMVNDIAIIKINGA 125
            |:||||.:    |.:|:|.|.   .:..||.....|.|      |..||:||:.||:.:||::.:
Zfish    60 VSAAHCYK----SRVQVRLGE---HNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSS 117

  Fly   126 LTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            ...:|.:|.:.|.||..::|.:..:||||.:|...|:.||:|..:|..|:|.|.|.::   |..|
Zfish   118 AQINSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNA---YPGQ 179

  Fly   191 IRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|.|.||.  ..|||:||||||||:|....|.|:||||||||..|.|||||.|....:|:
Zfish   180 ISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 95/226 (42%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 95/226 (42%)
Tryp_SPc 25..243 CDD:238113 96/227 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.