DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and prss60.2

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:268 Identity:104/268 - (38%)
Similarity:148/268 - (55%) Gaps:34/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVACALG--------GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ--RSGSHSCGGSIYS 62
            |:.:.|..|        |..|      |:.|||||......|:|||:|||  |.|.|.||||:.|
Zfish     9 LTLLICVKGSLSQLNVCGQAP------LNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLIS 67

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGV-----TFSVSSFKNHEGYNANTMVNDIAIIKI 122
            |..::||||||..||.|.|.:..|..  :..||     :.:|:....|..||:||..||||::::
Zfish    68 SEWVLTAAHCLPGVSESSLVVYLGRR--TQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRL 130

  Fly   123 NGALTFSSTIKAIGLASSNPANGAAAS--VSGWGTLSYG-SSSIPSQLQYVNVNIVSQSQCASST 184
            :.|:||:..|:.:.||:.|....|..|  ::|||.:..| :...|..||...:.:|:..:| ::.
Zfish   131 SSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC-NAQ 194

  Fly   185 YGYGSQIRSTMICA--AASGKDACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADVA 243
            .|.|: :.:.||||  |..|||.||||||||:|:.    .:..|:.|||||||..|.||||..|:
Zfish   195 LGSGT-VTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSPGVYTRVS 258

  Fly   244 ALRSWVIS 251
            ..:||:.|
Zfish   259 QYQSWISS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 96/234 (41%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 96/234 (41%)
Tryp_SPc 34..267 CDD:238113 97/237 (41%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.