DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and Sb

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:276 Identity:96/276 - (34%)
Similarity:139/276 - (50%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR------SGSHSCGGSI 60
            |..|..:||.....|  ||  .|.:.:.|||||.:.....:|||:|::|      |.:|.|||::
  Fly   519 LGHVKTISAARSECG--VP--TLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGAL 579

  Fly    61 YSSNVIVTAAHCLQSVSASVLQIRAGSSYWS---------SGGVTFSVSSFKNHEGYNANTMVND 116
            .:.|.|.||.||:..:..|.::||.|...:|         ..||...|.    |..|:..|...|
  Fly   580 INENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVV----HPKYSFLTYEYD 640

  Fly   117 IAIIKINGALTFSSTIKAIGLASSNP-ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQC 180
            :|::|:...|.|:..:..|.|..::. ..|..|:|:|||.||.| .::||.||.|:|.|||...|
  Fly   641 LALVKLEQPLEFAPHVSPICLPETDSLLIGMNATVTGWGRLSEG-GTLPSVLQEVSVPIVSNDNC 704

  Fly   181 ASSTYGYGSQ--IRSTMICAA--ASGKDACQGDSGGPLVSGG-----VLVGVVSWGYGCAYSNYP 236
            .|.....|.|  |....:||.  ..|:|:|||||||||.:..     .|.|::|||.|||.:|.|
  Fly   705 KSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLP 769

  Fly   237 GVYADVAALRSWVISN 252
            ||...::....|::.:
  Fly   770 GVCTRISKFTPWILEH 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 87/243 (36%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 87/243 (36%)
Tryp_SPc 544..785 CDD:238113 87/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.