DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and Sems

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:231 Identity:70/231 - (30%)
Similarity:112/231 - (48%) Gaps:5/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDGRIVGGSATTISSF-PWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQS-VSASVLQIRA 85
            |.|....|::||..||.:.. .:.::::...:..|||::....:::|||||.:. .......:..
  Fly    36 LPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDG 100

  Fly    86 GSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASV 150
            |.|..|..|:...|..|.....:...||..|:|::.:|..:. ...|..:.|.|:....|....|
  Fly   101 GISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMV-GKNIGTLSLCSTALTPGQTMDV 164

  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG-KDACQGDSGGPL 214
            ||||..:.........|:.|:|.::.:..|..: |.....|..:|.||:..| ||||..||||||
  Fly   165 SGWGMTNPDDEGPGHMLRTVSVPVIEKRICREA-YRESVSISDSMFCASVLGKKDACTYDSGGPL 228

  Fly   215 VSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            |....:.|:||:|.|||...|||||.||..::.:::
  Fly   229 VYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 68/221 (31%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 68/221 (31%)
Tryp_SPc 44..265 CDD:238113 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.