DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and CG32374

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:224 Identity:78/224 - (34%)
Similarity:111/224 - (49%) Gaps:2/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            |..|||.|.....|..|:|.:|..:....||..|.:...|:||.|| :..:.....:||||:...
  Fly    70 LPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC-KIGNPGRYTVRAGSTQQR 133

  Fly    92 SGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASV-SGWGT 155
            .||....|.....|..|:..||.||:.::|:...|.....::.:.|.|:.........: ||||.
  Fly   134 RGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGL 198

  Fly   156 LSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVL 220
            .|..:.::...|:.|.|..||:::|.....|.|.:|...||||....:|.|.||||||||..|||
  Fly   199 TSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVHNGVL 263

  Fly   221 VGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .|:.|:|.|||.:.|||||.:|.....|:
  Fly   264 YGITSFGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 76/219 (35%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 76/219 (35%)
Tryp_SPc 74..295 CDD:238113 76/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.