DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and thetaTry

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:118/257 - (45%)
Similarity:159/257 - (61%) Gaps:6/257 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILL--SAVACALGGT--VPEGLLPQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSI 60
            |.:.|:||  .||..|..||  |..|...:.:||||||..|||.:.|:|:||| :||||.||||:
  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65

  Fly    61 YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            .:.:.:|||||||.....|.:.:|.||:.::.||:..:|.....:|.||:.||..|:.|:|::..
  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130

  Fly   126 LTFSSTIKAIGLASSNPANGAAASVSGWGTLSY-GSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189
            :..:..|:.|.||:..|..|..|.|:|||:..| ...::|..||.|.||||....|||..|.||.
  Fly   131 VKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGE 195

  Fly   190 QIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            .|..:|:||....||||||||||||..|..|||:|||||.||.:..||||:||.|||.|:::
  Fly   196 IIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 105/220 (48%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 105/220 (48%)
Tryp_SPc 35..255 CDD:238113 104/219 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452476
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.840

Return to query results.
Submit another query.