DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and CG4271

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:223 Identity:64/223 - (28%)
Similarity:103/223 - (46%) Gaps:6/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGV 95
            |..|.......:.:..|:..||.|.|||::..|.:::|||.|:::.....:.:|.|:.....||.
  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGR 83

  Fly    96 TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGS 160
            ...|::...||.|  ....||||::.:...: .|..:..|.||:..|:.....|.:|||.....|
  Fly    84 IIRVTALVVHENY--KNWDNDIALLWLEKPV-LSVRVTKIPLATKEPSENEYPSNAGWGEKLLES 145

  Fly   161 SSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVS 225
            ..:..:||.....|..:|.||....   ..:...::||..:..|.|.||.|||||....:||:..
  Fly   146 YVVTRKLQNGVTKIRPRSMCAEELV---EPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAV 207

  Fly   226 WGYGCAYSNYPGVYADVAALRSWVISNA 253
            .|:||.::..|.:|.:|.....|:..||
  Fly   208 QGHGCGFAVLPSLYTNVFHYLEWIEENA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 61/217 (28%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 62/220 (28%)
Tryp_SPc 19..231 CDD:214473 61/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.