DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and CG11911

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:78/269 - (28%)
Similarity:125/269 - (46%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPE---GLLPQL-DGRIVGGSATTISSFPWQISLQRS---GSHSCGG 58
            ::...::::.||.|.|..:.:   .|:|.. .|.::.|:.....|.|:.:||..:   .||.|||
  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67

  Fly    59 SIYSSNVIVTAAHCL-QSVSASV---LQIRAG-SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIA 118
            ::.:.:.|||||||: :.|..|:   |..||. ........|.|.    :.||.|.......|||
  Fly    68 TLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFG----RVHEKYTGGVGPYDIA 128

  Fly   119 IIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            ::.:|.:..|:..::...|.|....:.....:.|||.......|....||.|...|::..:| ..
  Fly   129 LLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC-KE 192

  Fly   184 TYGYGSQIRSTMICAAA--SGKDACQGDSGGPLV-----SGGVLVGVVSWGY-GCAYSNYPGVYA 240
            .....:.|..:.||:::  ..|.||.||||||||     :...|:|:||||| .|..:|.|.:|.
  Fly   193 ELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYT 257

  Fly   241 DVAALRSWV 249
            .|:|...|:
  Fly   258 KVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 70/234 (30%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/235 (30%)
Tryp_SPc 37..266 CDD:214473 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.