DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaTry and LOC102554637

DIOPT Version :9

Sequence 1:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:91/254 - (35%)
Similarity:139/254 - (54%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            ::.:::|..|..|:...|.:      |.:||||......|.|:|:|| .||.|.||||:.:...:
  Rat     1 MRALLVLVLVGAAVAFPVDD------DDKIVGGYTCQEHSVPYQVSL-NSGYHYCGGSLINDQWV 58

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTF 128
            |:||||.:    |.:|:|.|....:  .|...| :.:....|..::..|:.|||.:||::..:..
  Rat    59 VSAAHCYK----SRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKL 119

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            ::.:..:.|.||....|....:|||| |||:|.:. |..||.::..::.|:.|.:|   |..:|.
  Rat   120 NARVATVALPSSCAPAGTQCLISGWGNTLSFGVND-PDLLQCLDAPLLPQADCEAS---YPGKIT 180

  Fly   193 STMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :.|:||.  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:
  Rat   181 NNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 85/224 (38%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 86/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.