DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and CAM1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:52/214 - (24%)
Similarity:90/214 - (42%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLV-DDGFSIWESRAILIYLV---------- 73
            |||.:|     :||:..:....:|.:..|...:|..| ..|:.:.|:.||..|||          
Yeast    22 KALKLD-----VKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEAMAINYYLVKLSQDDKMKT 81

  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEA-IYPQIRN-----------NHPADPEA 126
            :..||||.|   :.|.:.:           .:||...: :..||.|           |..:...|
Yeast    82 QLLGADDDL---NAQAQII-----------RWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSA 132

  Fly   127 MQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVST--FEVVDFDI---AQYPNVARWYENA 186
            |..||......:..|::..|:|.:.:::||: :.||:.|  ||.: |..   ||:|.:.||: |.
Yeast   133 MDAVDKIVDIFENRLKNYTYLATENISLADL-VAASIFTRYFESL-FGTEWRAQHPAIVRWF-NT 194

  Fly   187 KEVTPGWEENWDGVQLIKK 205
            ...:|..::.:...:...|
Yeast   195 VRASPFLKDEYKDFKFADK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 50/195 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/64 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/132 (22%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 17/55 (31%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 30/136 (22%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.