DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and URE2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:56/210 - (26%)
Similarity:89/210 - (42%) Gaps:42/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVD---DGFSIWESRAILIYLVEKY 76
            |.:....||...|...|....||...||||.:||...:|.|:|   |..|||||.|||::||.||
Yeast   128 VAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKY 192

  Fly    77 GADDS---LYPSDPQKKAVVNQRLYFD-------MGTLFQ----------SFVEAIYPQIRNNHP 121
            ..:..   |:..|...::.:|..|:|.       :|....          |.||....::|..:.
Yeast   193 YKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASAVERYTDEVRRVYG 257

  Fly   122 ADPEAM-QKVDSAFGHLDT-----------------FLEDQEYVAGDCLTIADIALLASVSTFEV 168
            ....|: ::.::....|||                 |.:...::.||.|||||:|.:...:..:.
Yeast   258 VVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLAFVPWNNVVDR 322

  Fly   169 VDFDI-AQYPNVARW 182
            :..:| .::|.|.:|
Yeast   323 IGINIKIEFPEVYKW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 56/210 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 26/61 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/131 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 29/65 (45%)
GST_C_Ure2p 208..350 CDD:198326 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.