DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and YGR201C

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:47/186 - (25%)
Similarity:79/186 - (42%) Gaps:19/186 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RSVIMTAKALGVDLNMKLLKVMDGEQL-KPEFVKLNPQHCIPTLV--DDGFSIWESRAILIYLV- 73
            |:::.......:.|::||....|.:|| :.||    |....||.|  .|.:::.|:.||..||: 
Yeast    17 RTIVPRGLVRSLKLDVKLADPSDAQQLYEREF----PLRKYPTFVGPHDEWTLTEAMAIDYYLIH 77

  Fly    74 ---EKYGADDSLYP-SDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQI---RNNHPADPEAMQKVD 131
               :|......|.| .|.:.:|.:.:..............|..:|.|   ..|......|.:.||
Yeast    78 LSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFKAARENVD 142

  Fly   132 SAFGHLDTFLEDQEY-VAGDCLTIADIALLASVSTFEVVDFD---IAQYPNVARWY 183
            :.....:..|:.|:| |..|..|:||:...|:.|...:..||   .:::|.|.||:
Yeast   143 TIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFISFFDETWRSKHPEVTRWF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 47/186 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/67 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/103 (23%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 19/64 (30%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.