DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF14

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:185 Identity:51/185 - (27%)
Similarity:84/185 - (45%) Gaps:15/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GVDLNMKLLKVMDGEQLKPEFVK-LNPQHCIPTLVDDGFSIWESRAILIYLVEKY-GADDSLYPS 85
            |:|..:..:..:.||.....|:. |||...:|.|.|....::|.:||..||.|:| ....:|.|.
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPD 91

  Fly    86 DPQKKAVVNQRLYFD-------MGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLED 143
            ||:|:|:::..:..|       ..||.:..:...|..:..:..|..|..:|:.......:|.|.:
plant    92 DPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATDDTAVQENKEKLSEVLNIYETRLGE 156

  Fly   144 QEYVAGDCLTIADIALLASVSTFEVVDFD-----IAQYPNVARWYENAKEVTPGW 193
            ..|:||:..::||:..||.:......|.:     |...||||.|.|..| :.|.|
plant   157 SPYLAGESFSLADLHHLAPIDYLLNTDEEELKNLIYSRPNVAAWVEKMK-MRPAW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 48/178 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/51 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/118 (25%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 16/52 (31%)
GST_C_Phi 94..214 CDD:198296 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.