Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955818.1 | Gene: | clic3 / 84040 | ZFINID: | ZDB-GENE-010507-2 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 41/199 - (20%) |
---|---|---|---|
Similarity: | 80/199 - (40%) | Gaps: | 38/199 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 CRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVK-LNPQHCIPTLVDDGFSIWESRAILIYLVEK 75
Fly 76 YGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQ-KVDSAFGHLDT 139
Fly 140 FL----------------EDQEYVAGDCLTIADIALLASVSTFEVV-----DFDI-AQYPNVARW 182
Fly 183 YENA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 41/199 (21%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 14/62 (23%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 23/122 (19%) | ||
clic3 | NP_955818.1 | GST_N_CLIC | 3..92 | CDD:239359 | 18/77 (23%) |
O-ClC | 6..237 | CDD:129941 | 41/199 (21%) | ||
GST_C_CLIC3 | 99..231 | CDD:198332 | 22/112 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589601 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |