DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and clic3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:199 Identity:41/199 - (20%)
Similarity:80/199 - (40%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVK-LNPQHCIPTLVDDGFSIWESRAILIYLVEK 75
            |:.:.|.....||:..:..:.:    :..||.:| |.|....|.|:.:|....::..|..:|   
Zfish    26 CQRLFMILWLKGVNFTLTTVDM----KRAPEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFL--- 83

  Fly    76 YGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQ-KVDSAFGHLDT 139
               :|:|.|  ||...:..:  |.:..|............|:|.:|...:.:: |...:...||.
Zfish    84 ---EDTLAP--PQYPKLCCR--YKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQ 141

  Fly   140 FL----------------EDQEYVAGDCLTIADIALLASVSTFEVV-----DFDI-AQYPNVARW 182
            :|                ..:.|:.|:.|::||..||..:...:||     .|:| |:...::::
Zfish   142 YLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGFEIPAELKGLSKY 206

  Fly   183 YENA 186
            .:.|
Zfish   207 LDKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 41/199 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/62 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/122 (19%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 18/77 (23%)
O-ClC 6..237 CDD:129941 41/199 (21%)
GST_C_CLIC3 99..231 CDD:198332 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.