DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF6

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:193 Identity:47/193 - (24%)
Similarity:84/193 - (43%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILI 70
            ||.|...|.|::......||.....:::.|||..|..|:..||...:|...|..|.|:|||||..
plant     9 HPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQ 73

  Fly    71 YLVEKYGADDSLYPSDPQKKAVVNQRL-----YFD-MGT--LFQSFVEAIYPQIRNNHPADPE-- 125
            |:..::....:...|..:..|::...:     .|| :|:  :::..::.:|....:....:.|  
plant    74 YIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEA 138

  Fly   126 AMQKVDSAFGHLDTFLEDQEYVAGDCLTIAD------IALLASVSTFEVVDFDIAQYPNVARW 182
            .:.||...:.|.   |.:.:|:|.|..|:.|      |..|....|.::.|    :.|:|:.|
plant   139 KLAKVLDVYEHR---LGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFD----ERPHVSAW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 47/193 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/67 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/111 (20%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 24/67 (36%)
GST_C_Phi 91..208 CDD:198296 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.