DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF5

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:219 Identity:49/219 - (22%)
Similarity:93/219 - (42%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            |.:|.|...|.|:......|:..:...:.::.|:|.||.|:.:||...:|..:|.|..:.|||||
plant    67 YGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAI 131

  Fly    69 LIYLVEKYGADDSLYPSDPQKKAVVNQRLY-------FDMGTLFQSFVEAIYPQ--IRNNHPADP 124
            ..|:...:.:..:...:....|.:..||::       ||..|...::.::|.|.  ::.::....
plant   132 SEYIATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKTDYKVVN 196

  Fly   125 EAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQY------------- 176
            |...|::......:..|::..::|.:..|:||:..|.::           ||             
plant   197 ETEAKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNI-----------QYLMDTHTKRMFVNR 250

  Fly   177 PNVARWYENAKEVT--PGWEENWD 198
            |:|.||   ..|:|  |.|:...|
plant   251 PSVRRW---VAEITARPAWKRACD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 44/205 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/135 (20%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 22/68 (32%)
GST_C_Phi 153..270 CDD:198296 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.