DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF4

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:235 Identity:50/235 - (21%)
Similarity:81/235 - (34%) Gaps:72/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIY 71
            |.|...|.|:.......:......:|:..||.....|:.|||...:|...|....::|||||..|
plant    43 PFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQY 107

  Fly    72 LVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSF-VEAIYPQIRNNHPADPEAM-----QKV 130
            :.         |....:...::|.|.:..|.||.... :||        |..||.|.     |.:
plant   108 IA---------YVHSSRGTQLLNLRSHETMATLTMWMEIEA--------HQFDPPASKLTWEQVI 155

  Fly   131 DSAFGHLDT---------------------FLEDQEYVAGDCLTIADIALLASV---------ST 165
            ...:| |:|                     .||:..::|.:..|:.|:..|.::         ..
plant   156 KPIYG-LETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKL 219

  Fly   166 FEVVDFDIAQYPNVARWYENAKEVT--PGW------EENW 197
            ||       :...|.:|.:   |:|  ..|      |::|
plant   220 FE-------KRSKVRKWVD---EITSREAWKMACDQEKSW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 45/216 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/66 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/154 (19%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 19/65 (29%)
GST_C_Phi 126..243 CDD:198296 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.