DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Clic4

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:206 Identity:44/206 - (21%)
Similarity:75/206 - (36%) Gaps:80/206 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILI 70
            ||......|.:.|      |:| |:.:.::.....|:::||:|:|  |          ||....:
  Rat    74 HPPFITFNSEVKT------DVN-KIEEFLEEVLCPPKYLKLSPKH--P----------ESNTAGM 119

  Fly    71 YLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEA--------M 127
            .:..|:.|                                    .|:|:.|...||        :
  Rat   120 DIFAKFSA------------------------------------YIKNSRPEANEALERGLLKTL 148

  Fly   128 QKVDSAF-----GHLD-TFLED-----QEYVAGDCLTIADIALLASVSTFEVV-----DFDIAQ- 175
            ||:|...     |.:| ..:||     :.::.||.:|:||..||..:...:||     :|||.: 
  Rat   149 QKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKG 213

  Fly   176 YPNVARWYENA 186
            ...:.|:..||
  Rat   214 MTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 44/206 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/67 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/124 (22%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 7/33 (21%)
GST_N_CLIC 14..104 CDD:239359 8/36 (22%)
O-ClC 17..252 CDD:129941 44/206 (21%)
GST_C_family 111..251 CDD:295467 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.