Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_114006.1 | Gene: | Clic4 / 83718 | RGDID: | 61857 | Length: | 253 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 75/206 - (36%) | Gaps: | 80/206 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 HPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILI 70
Fly 71 YLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEA--------M 127
Fly 128 QKVDSAF-----GHLD-TFLED-----QEYVAGDCLTIADIALLASVSTFEVV-----DFDIAQ- 175
Fly 176 YPNVARWYENA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 44/206 (21%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 15/67 (22%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 27/124 (22%) | ||
Clic4 | NP_114006.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 2..101 | 7/33 (21%) | |
GST_N_CLIC | 14..104 | CDD:239359 | 8/36 (22%) | ||
O-ClC | 17..252 | CDD:129941 | 44/206 (21%) | ||
GST_C_family | 111..251 | CDD:295467 | 33/162 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166347842 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |