DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTT3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:231 Identity:61/231 - (26%)
Similarity:107/231 - (46%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            |....|.|.|:|::..|...:..:..|:.:.:.:||.|||..:||...:|.:||....:.||.||
plant     6 YADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHAI 70

  Fly    69 LIYLVEKY-GADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRN-------NHPADPE 125
            ||||...| ...|..||:|..|:|.::..|.:....|.......:...:..       |..|..|
plant    71 LIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPKAAAE 135

  Fly   126 AMQKVDSAFGHLDTFLEDQEYVAGDCL--------TIADIALLASVSTFEVVDFD-----IAQYP 177
            |.|.:..:...||||     ::.|:.:        :|||::|:..::..:|:|..     ::.:.
plant   136 AEQLLTKSLTTLDTF-----WLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSPHK 195

  Fly   178 NVARWYENAKEVT-PGWEENWDGVQLIKKLVQERNE 212
            ||.:|.||.::.| |.::|..:.:...|...|::.|
plant   196 NVEQWIENTRKATMPHFDEVHEVLFRAKDRCQKQRE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 55/204 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/69 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/136 (21%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 53/200 (27%)
GST_N_Theta 3..78 CDD:239348 25/71 (35%)
GST_C_Theta 92..221 CDD:198292 28/133 (21%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.