DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:219 Identity:53/219 - (24%)
Similarity:82/219 - (37%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILI 70
            ||.|...|.|::......:|..:..:::.|||..|..|:..||...:|...|....::|||||..
plant     9 HPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQ 73

  Fly    71 YLVEKYGADDSLYPSDPQKKAVVNQ---RLYFDMGTLFQSFVEAIYPQIRNNHPADPEAM----- 127
            |:..:|                .||   .|..|...:.|..:.||..|: .:|..||.|.     
plant    74 YIAHRY----------------ENQGTNLLQTDSKNISQYAIMAIGMQV-EDHQFDPVASKLAFE 121

  Fly   128 QKVDSAFG-----------------HLDTF---LEDQEYVAGDCLTIAD------IALLASVSTF 166
            |...|.:|                 .||.:   |::.:|:||:..|:.|      |..|....|.
plant   122 QIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTK 186

  Fly   167 EVVDFDIAQYPNVARWYENAKEVT 190
            ::    ..:.|.|..|   ..|:|
plant   187 KL----FTERPRVNEW---VAEIT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 51/215 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/67 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/137 (23%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 21/68 (31%)
GST_C_Phi 96..211 CDD:198296 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.