DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and AT3G47680

DIOPT Version :10

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:38 Identity:12/38 - (31%)
Similarity:18/38 - (47%) Gaps:6/38 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GFSIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQR 96
            |::.| || |..|    |||...|...:.::...:.||
plant    77 GYAFW-SR-IAAY----YGASPKLNGVEKRETGHIKQR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GST_N_Delta_Epsilon 1..74 CDD:239343 6/14 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 2/9 (22%)
AT3G47680NP_190352.1 None

Return to query results.
Submit another query.