DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF11

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:217 Identity:53/217 - (24%)
Similarity:87/217 - (40%) Gaps:63/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKY---GADDS 81
            :.:.|||: ||      ||.||:.:...|...:|.:.|....::|||||..|...||   |.|  
plant    29 EVIHVDLD-KL------EQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTD-- 84

  Fly    82 LYPSDPQKKAVVNQRL-----YF-------DMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAF 134
            |.....:.:|:|:|.:     ||       .|..:|:.         ::..|.|...::::...|
plant    85 LLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKP---------KSGKPCDVALVEELKVKF 140

  Fly   135 GH-LDTF---LEDQEYVAGDCLTIADIALL---------ASVSTFEVVDFDIAQYPNVARWYENA 186
            .. ||.:   |....|:.||..|:||::.:         .|:|..      :....|:.||: |.
plant   141 DKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGL------VTSRENLNRWW-NE 198

  Fly   187 KEVTPGWEENWDGVQLIKKLVQ 208
            ....|.|          |||::
plant   199 ISARPAW----------KKLME 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 48/195 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/53 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/140 (19%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 53/217 (24%)
GST_N_Phi 2..77 CDD:239351 18/54 (33%)
GST_C_Phi 91..209 CDD:198296 29/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.