DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF8

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:222 Identity:61/222 - (27%)
Similarity:95/222 - (42%) Gaps:45/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAPCRSVIMTA-KALGVDLN---MKLLKVMDGEQLKPEFV---------------KLNPQHCIPT 54
            |:...|:||.: |..||.::   |::|..:..:.|:.|.:               .|||...||.
plant    41 SSSSSSIIMASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPA 105

  Fly    55 LVDDGFSIWESRAILIYLVEKYG-ADDSLYPSDPQK-KAVVNQRL-----YFDMGT---LFQSFV 109
            |.|...:::|||||..||.|:|. ..:.|...|.:| ||..|..|     .||...   .|:...
plant   106 LEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVF 170

  Fly   110 EAIYPQIRNNHPADPEAMQKVDSAFGH-LDTF---LEDQEYVAGDCLTIADIALLASV----STF 166
            :.::     ....||.|:|:::..... ||.:   |...|::|||..|:||:..|.::    .|.
plant   171 KGMF-----GMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTD 230

  Fly   167 EVVDFDIAQYPNVARWYENAKEVTPGW 193
            ..|.||  ..|.|:.|.:.. ...|.|
plant   231 SKVLFD--SRPKVSEWIKKI-SARPAW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 59/215 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/83 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/123 (26%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.