DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTF3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:217 Identity:51/217 - (23%)
Similarity:80/217 - (36%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILI 70
            ||.|...|.|::......:|..:..:::.|||..|..|:..||...:|...|....::|||||..
plant     9 HPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQ 73

  Fly    71 YLVEKY-GADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQ------ 128
            |:..:| ....:|.|:|.:     |...|..|....|  |||        |..||.|.:      
plant    74 YIAHRYENQGTNLLPADSK-----NIAQYAIMSIGIQ--VEA--------HQFDPVASKLAWEQV 123

  Fly   129 -------------------KVDSAFGHLDTFLEDQEYVAGDCLTIAD------IALLASVSTFEV 168
                               |:.......:..|::.:|:||:..|:.|      |..|....|.::
plant   124 FKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKL 188

  Fly   169 VDFDIAQYPNVARWYENAKEVT 190
                ..:.|.|..|   ..|:|
plant   189 ----FTERPRVNEW---VAEIT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 49/213 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/67 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/134 (19%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 51/217 (24%)
GST_N_Phi 4..78 CDD:239351 21/68 (31%)
GST_C_Phi 96..212 CDD:198296 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.