DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:221 Identity:42/221 - (19%)
Similarity:86/221 - (38%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            |:...|...:.|.:.....|:....:.:.:...|..:|.|::||....:|.::.....|.:...|
Human    50 YHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQI 114

  Fly    69 LIYLVEKY-----GADDSLYPSDPQKKAVVNQR---LYFDMGTLFQSFVEAIYPQIRNNHPADPE 125
            :.|:...:     |...|.:|:.|  .||..:.   |..::|:|..:.| ..|.::.:..|.|  
Human   115 IDYVERTFTGGGRGRCPSGFPAQP--LAVPTEHVVALMPEVGSLQHARV-LQYRELLDALPMD-- 174

  Fly   126 AMQKVDSAFGH-------LDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWY 183
                   |:.|       |.|.....:|..      |:|....:.:|.:::..|..:.|.::..|
Human   175 -------AYTHGCILHPELTTDSMIPKYAT------AEIRRHLANATTDLMKLDHEEEPQLSEPY 226

  Fly   184 ENAKEVTPGWEENWDGVQLIKKLVQE 209
            .:.::.........|.|..:||::.|
Human   227 LSKQKKLMAKILEHDDVSYLKKILGE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 37/198 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/69 (19%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/125 (18%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 42/221 (19%)
GST_N_GDAP1 47..119 CDD:239350 13/68 (19%)
GST_C_GDAP1L1 220..330 CDD:198335 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.