DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Gstz1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:179 Identity:55/179 - (30%)
Similarity:89/179 - (49%) Gaps:17/179 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKAL-GVDLNMKLLKVM--DGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73
            |...:..|.|| |:|..:..:.::  .|:|...||..|||...:|.|..||.:|.:|.|||.|| 
  Rat    16 CSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITIGQSLAILEYL- 79

  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVE-----AIYPQIRNNHPADPEAMQKVDSA 133
            |:......|.|.||||:|:|  |:..|   |..|.::     ::..|:...:.. |.|.:.:.|.
  Rat    80 EETRPIPRLLPQDPQKRAIV--RMISD---LIASGIQPLQNLSVLKQVGQENQM-PWAQKAITSG 138

  Fly   134 FGHLDTFLEDQ--EYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVA 180
            |..|:..|:..  :|..||.:::||:.|...|:..|....|::.||.::
  Rat   139 FNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERFKVDLSPYPTIS 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 55/179 (31%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/64 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/100 (26%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 24/64 (38%)
maiA 7..211 CDD:273527 55/179 (31%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/2 (50%)