DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Eef1e1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:138 Identity:40/138 - (28%)
Similarity:68/138 - (49%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPTL-VDDGFSIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQ 115
            ||.| .::|.|:.....|..:|| |..:.:.|..|..::||:|.|.|.|.:..:           
Mouse    30 IPVLQTNNGPSLMGLSTIATHLV-KQASKEHLLGSTAEEKAMVQQWLEFRVTRV----------- 82

  Fly   116 IRNNHPA--DPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQ--- 175
              :.|.:  |.:.:.|      .|:::|||:.|:||..:|:|||.|...:..| :||..:.:   
Mouse    83 --DGHSSKEDTQTLLK------DLNSYLEDKVYLAGHNITLADILLYYGLHRF-IVDLTVQEKEK 138

  Fly   176 YPNVARWY 183
            |.||:||:
Mouse   139 YLNVSRWF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 40/138 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 7/22 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/101 (29%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 9/26 (35%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 29/103 (28%)
GST_C_AIMP3 65..165 CDD:198338 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.