DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstD10

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:206 Identity:126/206 - (61%)
Similarity:157/206 - (76%) Gaps:1/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMK-LLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWE 64
            ||.||.|.|||||||:||||||||:.:.| ::.....||..||::|:||||.||||.|.||::||
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

  Fly    65 SRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQK 129
            ||||::|||||||.||.|:|.|.||:|::|||||||||||::||.|..||||....||:.|..:|
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKK 130

  Fly   130 VDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWE 194
            ::.||..|:||||.|.|.||...::||||.||:||||:|..||..:|.||||||||||::|||||
  Fly   131 IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWE 195

  Fly   195 ENWDGVQLIKK 205
            |||.|.|..:|
  Fly   196 ENWAGCQEFRK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 114/187 (61%)
GST_N_Delta_Epsilon 1..74 CDD:239343 45/73 (62%)
GST_C_Delta_Epsilon 88..204 CDD:198287 70/115 (61%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 45/73 (62%)
PLN02473 3..196 CDD:166114 117/192 (61%)
GST_C_Delta_Epsilon 89..205 CDD:198287 70/115 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468462
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.