DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gstr

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:231 Identity:57/231 - (24%)
Similarity:94/231 - (40%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYHPCSAPC-RSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWE 64
            |..|:...|.|| |.:|...:........|||.....|...||...|||:..:||.......:.|
Zfish     5 MLLYWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNE 69

  Fly    65 SRAILIYLVEKYGADDS-LYPSDPQKKAVVNQRLYFDMGTLFQSFVE-AIYPQIRNNHPADPEAM 127
            |.|..:||...:.:..: |.|.:|.:.|:|.||: |:...|.|...| |.|..:      .||. 
Zfish    70 SFAACLYLESVFKSQGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWL------VPEG- 126

  Fly   128 QKVDSAF---------------GHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYP 177
            ::::||.               |:|:. :....|:||...::||:.....::.|..:.....:.|
Zfish   127 ERLESALKRNKEKLIEELKLWEGYLEK-MGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPKERCP 190

  Fly   178 NVARWYENAKE---VTPGWEENW----DGVQLIKKL 206
            .:..:||..|:   :...|...|    .|..::|.|
Zfish   191 RLMEYYEMVKDRPSIKASWPPEWLEKPVGEDILKSL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 51/204 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/138 (21%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 52/210 (25%)
GST_N_family 5..78 CDD:238319 22/72 (31%)
GST_C_family 99..199 CDD:198286 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.