DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gdap1l1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:225 Identity:36/225 - (16%)
Similarity:73/225 - (32%) Gaps:74/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADD--SLYPSD--PQKKAVVNQRL 97
            ||.:|.|::||....:|..:.....:.:...|:.|:...:..|.  .|.|.:  |....|...|.
Zfish    84 EQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRE 148

  Fly    98 YFDMGTLFQSFVEA--IYPQIRNN-------------HPADPEA-MQKVD--------------- 131
            ..| |....::...  ::|::..:             |.|:..: :.|:|               
Zfish   149 LLD-GLPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANAASELMKLDHEEPQLTEPYLSKQK 212

  Fly   132 ----------------SAFGHLDTFLEDQE-----------------YVAGDCLTIADIALLASV 163
                            ...|.|...|:..|                 ::.|...|:|||.|.|::
Zfish   213 KLMAKILDHDNVNYLKKILGELAMVLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATL 277

  Fly   164 STFEVVD-----FDIAQYPNVARWYENAKE 188
            ...:.:.     ::....||:..::|..::
Zfish   278 HRLKFLGLSRKYWEDGSRPNLQSFFERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 36/223 (16%)
GST_N_Delta_Epsilon 1..74 CDD:239343 9/36 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/170 (14%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 36/225 (16%)
Thioredoxin_like 48..120 CDD:294274 9/35 (26%)
GST_C_GDAP1L1 201..311 CDD:198335 14/107 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.