Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018511.1 | Gene: | gdap1 / 553702 | ZFINID: | ZDB-GENE-050522-424 | Length: | 362 | Species: | Danio rerio |
Alignment Length: | 234 | Identity: | 41/234 - (17%) |
---|---|---|---|
Similarity: | 80/234 - (34%) | Gaps: | 80/234 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYPSDPQK 89
Fly 90 KAVVNQRLYFDMGTLFQSFVEA------IYPQIR-NNH-PA------------------------ 122
Fly 123 -------------------DPEAMQKVDSAFGHLDTFLE------------------DQEYVAGD 150
Fly 151 CLTIADIALLASVSTFEVVDFDIAQYPNVAR-----WYE 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 41/234 (18%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 16/48 (33%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 23/171 (13%) | ||
gdap1 | NP_001018511.1 | GstA | 40..307 | CDD:223698 | 41/234 (18%) |
GST_N_GDAP1 | 40..112 | CDD:239350 | 15/47 (32%) | ||
GST_C_family | 193..304 | CDD:295467 | 15/104 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589665 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |