DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gdap1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:234 Identity:41/234 - (17%)
Similarity:80/234 - (34%) Gaps:80/234 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYPSDPQK 89
            |:::.|     .|..:|.|::|||...:|.||.|...|.:...|:.||.:.: .|:......|::
Zfish    69 DVSLPL-----SEHNEPWFMRLNPTGEVPVLVHDNHVICDPTQIMDYLEQNF-CDEQTPKLIPEE 127

  Fly    90 KAVVNQRLYFDMGTLFQSFVEA------IYPQIR-NNH-PA------------------------ 122
            .:....|:......|....::|      ::|:|. ::| ||                        
Zfish   128 GSTYYHRVQHYRELLDSLQMDAYTHGCILHPEITVDSHIPAYATTHIRTQIGNTESELKKLAVEN 192

  Fly   123 -------------------DPEAMQKVDSAFGHLDTFLE------------------DQEYVAGD 150
                               |.:.|:.:......|:..|:                  .|.::.||
Zfish   193 PDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLDQVETELQRRSEETPEEGSQQAWLCGD 257

  Fly   151 CLTIADIALLASVSTFEVVDFDIAQYPNVAR-----WYE 184
            ..:|||::|..::...:.:......:.|..|     :||
Zfish   258 FFSIADVSLAVTLHRLKFLGLSRRYWGNGMRVNLETYYE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 41/234 (18%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/48 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/171 (13%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 41/234 (18%)
GST_N_GDAP1 40..112 CDD:239350 15/47 (32%)
GST_C_family 193..304 CDD:295467 15/104 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.