DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GDAP1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens


Alignment Length:255 Identity:45/255 - (17%)
Similarity:93/255 - (36%) Gaps:82/255 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPCSAPCRSVIMTAKALGV---DLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRA 67
            |..|:....:::..|||..   |:::.|     .|..:|.|::||....:|.|:.....|.|:..
Human    33 HSFSSQKVRLVIAEKALKCEEHDVSLPL-----SEHNEPWFMRLNSTGEVPVLIHGENIICEATQ 92

  Fly    68 ILIYLVEKYGADDSLYPSDPQKKAVVNQRLY-------------FDMGTLF--QSFVEAIYP--- 114
            |:.||.:.: .|:......|.|:::...|:.             :..|.:.  :..|:::.|   
Human    93 IIDYLEQTF-LDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYA 156

  Fly   115 ------QIRN----------NHPADPEA------------------------MQKVDSAFGHLDT 139
                  ||.|          .:|...||                        :.:::.....::|
Human   157 TTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVET 221

  Fly   140 FLE----------DQEYVAGDCLTIADIALLASVSTFEVVDFDIAQY-----PNVARWYE 184
            .|:          .|.::.|:..|:||::|..::...:.:.|....:     ||:..:||
Human   222 ELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 45/255 (18%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/70 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/170 (14%)
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 18/69 (26%)
GST_C_GDAP1 179..289 CDD:198336 16/103 (16%)
Required for mitochondrial localization 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.