DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and CLIC5

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:140 Identity:31/140 - (22%)
Similarity:67/140 - (47%) Gaps:32/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VEKYGADDSLYPSDPQKKAVVNQR---LYFDMGTLFQSFVEAIYPQIRNNHPAD---PEAMQKVD 131
            :|:: .:::|.|....|.|..::.   ...|:.:.|.::::....|  ||...:   .:|::|:|
Human   247 IEEF-LEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQ--NNAALERGLTKALKKLD 308

  Fly   132 SAFGHLDTFLEDQ--------------EYVAGDCLTIADIALLASVSTFEVV-----DFDI-AQY 176
            .   :|:|.|.::              :::.||.||:||..||..:...::|     ::|| |:.
Human   309 D---YLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEM 370

  Fly   177 PNVARWYENA 186
            ..:.|:.:||
Human   371 TGLWRYLKNA 380

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 31/140 (22%)