DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and clic5a

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:239 Identity:49/239 - (20%)
Similarity:85/239 - (35%) Gaps:91/239 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSI----WESRAILIYL----- 72
            ||:...|.|.:::|            |||..         .||.||    :..|..:|..     
Zfish     1 MTSNEEGKDPDIEL------------FVKAG---------SDGESIGNCPFSQRLFMILWLKGVV 44

  Fly    73 -------VEKYGAD-DSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAI-----YPQ--------- 115
                   :::..|| .:|.|..|......|..:..|:..: :.|:|.:     ||:         
Zfish    45 FNVTTVDLKRKPADLHNLAPGTPPPFLTFNGEVRTDVNKI-EEFLEEMLAPPKYPKLAAKNKESN 108

  Fly   116 -------------IRNNHPADPEAMQK-VDSAFGHLDTFL------------------EDQEYVA 148
                         |:|..|....:::| :......||:||                  .:::|:.
Zfish   109 TAGNDIFAKFSAYIKNTKPEANASLEKGLLKVLKKLDSFLNSPLPDEIDAESTGEEKSSNRKYLD 173

  Fly   149 GDCLTIADIALLASVSTFEVV-----DFDI-AQYPNVARWYENA 186
            |:.||:||..||..:...:||     :|:| :....|.|:.:||
Zfish   174 GNELTLADCNLLPKLHVVKVVSKKYRNFEIPSDLSGVWRYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 49/239 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/72 (19%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/151 (20%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 20/110 (18%)
O-ClC 10..244 CDD:129941 45/230 (20%)
GST_C_CLIC5 104..244 CDD:198330 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.