DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstD7

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:210 Identity:120/210 - (57%)
Similarity:160/210 - (76%) Gaps:1/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65
            :|.|..|.:...|::.|.|||||::||.||:..|:|:|||||||::||||.||||||:||.||||
  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68

  Fly    66 RAILIYLVEKYGADDS-LYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQK 129
            |||.:|||||||..|| |||:||||:|::|||||||||||:.:..:..:...|.....|.||:.|
  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDK 133

  Fly   130 VDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWE 194
            |:||||.|:||||.|::|||..||:|||.:||:|||.|...||::::|||.||.:||.:||||||
  Fly   134 VNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWE 198

  Fly   195 ENWDGVQLIKKLVQE 209
            :|.:.:|..||.:|:
  Fly   199 QNLESLQQGKKFLQD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 109/187 (58%)
GST_N_Delta_Epsilon 1..74 CDD:239343 44/72 (61%)
GST_C_Delta_Epsilon 88..204 CDD:198287 61/115 (53%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 44/72 (61%)
GstA 6..188 CDD:223698 106/181 (59%)
GST_C_Delta_Epsilon 92..206 CDD:198287 60/113 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468498
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.