DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstD4

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:208 Identity:134/208 - (64%)
Similarity:171/208 - (82%) Gaps:0/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65
            |||||.|.|:..|::||.|||||::||.|.|::.:||.|||||:||||||.||||||:||:||||
  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65

  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKV 130
            |||.:|||||||.||||:|:||||:|::|||||||||||..||::..||.||.....:.|..:||
  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKV 130

  Fly   131 DSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWEE 195
            ::||..||.|||.|:||||..||:||||:|:||||||||:|||::||||||||.|||::||||:|
  Fly   131 EAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDE 195

  Fly   196 NWDGVQLIKKLVQ 208
            ||.|:..:|.:.:
  Fly   196 NWKGLLQMKTMYE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 124/186 (67%)
GST_N_Delta_Epsilon 1..74 CDD:239343 49/72 (68%)
GST_C_Delta_Epsilon 88..204 CDD:198287 72/115 (63%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 121/182 (66%)
GST_N_Delta_Epsilon 1..74 CDD:239343 49/72 (68%)
GST_C_Delta_Epsilon 88..204 CDD:198287 72/115 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468482
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.