DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstD3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:194 Identity:110/194 - (56%)
Similarity:145/194 - (74%) Gaps:0/194 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDS 81
            |..||||::.|.|::..:.|||:.|:|:|:||||.||||||:||:||||||||:|||||||.||:
  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65

  Fly    82 LYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLEDQEY 146
            |||.|.||:||:||||||||..::.:.....|...........|..:||...|..|:||||.|:|
  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDY 130

  Fly   147 VAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWEENWDGVQLIKKLVQER 210
            ||||..|:||||:||:||.|:||.|||::||||||||::.|::||||||||.|...:||.::|:
  Fly   131 VAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIEEK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 97/170 (57%)
GST_N_Delta_Epsilon 1..74 CDD:239343 35/56 (63%)
GST_C_Delta_Epsilon 88..204 CDD:198287 61/115 (53%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 35/56 (63%)
GstA 6..173 CDD:223698 95/166 (57%)
GST_C_Delta_Epsilon 72..188 CDD:198287 61/115 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468465
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.