DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:205 Identity:54/205 - (26%)
Similarity:95/205 - (46%) Gaps:34/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMD----GEQLK-PEFVKLNPQHCIPTL-VDDGFSI 62
            |.:|.:......::.|:..|..     :||.|    ||..| .||:|..|...:|.. ..:|..:
  Fly     7 YTYPENFRAYKALIAAQYSGAQ-----VKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYL 66

  Fly    63 WESRAILIYLVEKYGADDSLYPSD-PQKKAVVNQRLYFDMGTLFQSF------VEAIYPQIRNNH 120
            .||.|| .||:    |::.|.... |..:|.|.|.:.|....:..:.      :..|.||.:|: 
  Fly    67 SESNAI-AYLL----ANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNS- 125

  Fly   121 PADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLAS-VSTFE-VVDFDI-AQYPNVARW 182
                .|.|:.::....|:..|:|..::||:.:|:|||.:.:| :..:| |::..: :.:.||.||
  Fly   126 ----TAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRW 186

  Fly   183 YE---NAKEV 189
            :.   |.|:|
  Fly   187 FVTILNQKQV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 52/202 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/75 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/114 (25%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 23/81 (28%)
GstA 5..187 CDD:223698 50/194 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 29/112 (26%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.