DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gsto1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:192 Identity:45/192 - (23%)
Similarity:78/192 - (40%) Gaps:40/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMTAKALGVD-LNMKLLKVMDGEQLKPE-FVKLNPQHCIPTL-VDDGFSIWESRAILIYLVEKY 76
            :::.||.:..| :|:.|       :.||: |::.||...:|.| ...|..|:||.....||.|.|
Zfish    39 LVLNAKGIKYDTININL-------KNKPDWFLEKNPLGLVPVLETQSGQVIYESPITCEYLDEVY 96

  Fly    77 GADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFL 141
             .:..|.|.||.::|  .||:..:   ||.......|     ..|.:....:.|.:    |:|.|
Zfish    97 -PEKKLLPFDPFERA--QQRMLLE---LFSKVTPYFY-----KIPVNRTKGEDVSA----LETEL 146

  Fly   142 EDQ-------------EYVAGDCLTIADIALLASVSTFEVVDFD--IAQYPNVARWYENAKE 188
            :|:             ::..||.:|:.|..:.......|.::..  :...|.:.:|.|...|
Zfish   147 KDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGTPELKKWTERMME 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 44/190 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/61 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/116 (18%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 17/60 (28%)
GstA 25..210 CDD:223698 45/192 (23%)
GST_C_Omega 107..229 CDD:198293 21/116 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.