DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and se

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:184 Identity:45/184 - (24%)
Similarity:76/184 - (41%) Gaps:44/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VMDGEQL-----------KPEF-VKLNPQHCIPTLV---DDGFSI-WESRAILIYLVEKYGADDS 81
            |:|.:|:           |||: ::.|||..:|.|.   :.|..: .||..|..||.|:|.. ..
  Fly    39 VLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPL-RP 102

  Fly    82 LYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLED--- 143
            |||.||.||  |..:|..:.   |::.:.|.:   :.:...|.|..      :..||.:..:   
  Fly   103 LYPRDPLKK--VQDKLLIER---FRAVLGAFF---KASDGGDLEPF------WSGLDIYERELAR 153

  Fly   144 --QEYVAGDCLTIADIAL--------LASVSTFEVVDFDIAQYPNVARWYENAK 187
              .|:..|:...|.|..:        |..:...|..::|.:::|.:..|.|..|
  Fly   154 RGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 45/184 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/56 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/113 (19%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 16/55 (29%)
GstA 22..215 CDD:223698 45/184 (24%)
GST_C_Omega 109..229 CDD:198293 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.