DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstE12

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:218 Identity:82/218 - (37%)
Similarity:123/218 - (56%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            ||...|.|.|:|::||||:|:||.::.:.::.||.|.|||:||||||.||||:|...:|.:|.||
  Fly     7 YYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAI 71

  Fly    69 LIYLVEKYG-ADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPAD--PEAMQKV 130
            ..||||||| .:..|||.:..::|.|:.||:.|.|.|| :.:..:|..|......|  .:.:..:
  Fly    72 CAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLF-ARLRFLYEPILYYGSTDCSIDKIAYI 135

  Fly   131 DSAFGHLDTFLEDQEYVAGDCLTIADIALLASV-STFEVVDFDIAQYPNVARWYENAKEVTPGWE 194
            ...:..|:.||:||.|:.|..|||||...:|:| |..:....|..::|.:..|.:...|:....|
  Fly   136 QKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQE 200

  Fly   195 ENWDGVQLIK-----KLVQERNE 212
            .|.||...:|     ||.:.|.:
  Fly   201 VNGDGADELKSIFKAKLAENRGK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 73/187 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 36/69 (52%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/118 (29%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 36/69 (52%)
GstA 6..201 CDD:223698 74/194 (38%)
GST_C_Delta_Epsilon 92..210 CDD:198287 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460273
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.