DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstE11

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:220 Identity:88/220 - (40%)
Similarity:130/220 - (59%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            ||.|.|.|||:|::||.|||::|:::|:.|..||....||:|||.||.||.|.|:|..:.:|..|
  Fly     8 YYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72

  Fly    69 LIYLVEKYG--ADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQI---RNNHPADPEA-M 127
            ..||.:||.  .||||||.||:|:.:|:.|||:|.|.||......:.|.|   ....|:|..| :
  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAYL 137

  Fly   128 QKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEV-VDFDIAQYPNVARWYENAKEVTP 191
            ||   |:..|:..|.:.:|:.||.|||||::.:|||||.|. ...:..|:|.:.:|.:..:.:..
  Fly   138 QK---AYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALPY 199

  Fly   192 GWEENWDG----VQLIKKLVQERNE 212
            ..:.|.:|    |.|:|.|:.||.:
  Fly   200 YQKNNQEGLDMLVGLVKGLLAERQQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 80/190 (42%)
GST_N_Delta_Epsilon 1..74 CDD:239343 34/69 (49%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/124 (32%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 80/192 (42%)
GST_N_Delta_Epsilon 5..78 CDD:239343 34/69 (49%)
GST_C_Delta_Epsilon 94..211 CDD:198287 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460274
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.