DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstE6

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:207 Identity:77/207 - (37%)
Similarity:125/207 - (60%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73
            |.|.|:|.:|..||.:......:.::...||.||:::.||||.:|||.|||..||:|.||:.|||
  Fly    12 SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76

  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQI--RNNHPADPEAMQKVDSAFGH 136
            .||...|:|||.||.|:|||:|||:|:.|.:|.:.:.:|...:  :.......|....:...:..
  Fly    77 SKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDF 141

  Fly   137 LDTFLEDQEYVAGDCLTIADIALLASVSTFEV-VDFDIAQYPNVARWYENAKEVTPGWEE-NWDG 199
            ::|||:.|:|:||:.|||||.:|::||::.|. |..|..:||.:..|.:..::: |.:|| |..|
  Fly   142 VETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL-PYYEEANGKG 205

  Fly   200 VQLIKKLVQERN 211
            |:.:..:.::.|
  Fly   206 VRQLVAIFKKTN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 70/181 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 28/64 (44%)
GST_C_Delta_Epsilon 88..204 CDD:198287 39/119 (33%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 70/184 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/64 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460272
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.