DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstE2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:201 Identity:79/201 - (39%)
Similarity:115/201 - (57%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73
            |.|.|:..:|.:||.:|...|.:.::.|:..|..|:|.||||.:|.|.|:|..||:|.||:.|||
  Fly    13 SPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLV 77

  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQ-IRNNHPADPEAMQKVDSAFGHL 137
            :||...|.|||.|...:|.|:|||:||...||.|......|. :|.......|.:..:..|:|||
  Fly    78 DKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHL 142

  Fly   138 DTFLEDQEYVAGDCLTIADIALLASVSTF-EVVDFDIAQYPNVARWYENAKEVTPGWEENWDGVQ 201
            :.||.|..|:.|..|||||:...|:.|:. .|:|.|..:||.||.|:|...:: |.:||  |.::
  Fly   143 ENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKL-PHYEE--DNLR 204

  Fly   202 LIKKLV 207
            .:||.:
  Fly   205 GLKKYI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 73/180 (41%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/64 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 42/117 (36%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 73/183 (40%)
GST_N_Delta_Epsilon 5..78 CDD:239343 27/64 (42%)
GST_C_Delta_Epsilon 94..209 CDD:198287 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460267
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.