DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and clic4

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:200 Identity:44/200 - (22%)
Similarity:72/200 - (36%) Gaps:68/200 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VDLNMK---LLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYPS 85
            |||..|   |..:..|..  |.|:..|.:  :.|.|:.              :|:| .:|.|.|.
Zfish    56 VDLKRKPADLQNLAPGTH--PPFITFNGE--VKTDVNK--------------IEEY-LEDILCPP 101

  Fly    86 DPQK---KAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLEDQEYV 147
            ...|   :...:.....|:...|.:|       |:|:.|...||:::     |.|.|..:..||:
Zfish   102 KYSKLGARHPESNTAGMDIFAKFSAF-------IKNSKPDANEALER-----GLLKTLQKLDEYL 154

  Fly   148 A------------------------GDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKE 188
            .                        |:.:|:||..||..:...:||   ..:|    |.:|..|:
Zfish   155 CSPLPDEIDHNSMEEVKASTRMFLDGEEMTLADCNLLPKLHIVKVV---AKKY----RGFEIPKD 212

  Fly   189 VTPGW 193
            :|..|
Zfish   213 LTGIW 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 41/193 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 11/52 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/132 (20%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 16/65 (25%)
O-ClC 16..250 CDD:129941 43/199 (22%)
GST_C_CLIC4 110..250 CDD:198329 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.