Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_958894.1 | Gene: | clic4 / 368255 | ZFINID: | ZDB-GENE-030326-3 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 44/200 - (22%) |
---|---|---|---|
Similarity: | 72/200 - (36%) | Gaps: | 68/200 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 VDLNMK---LLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYPS 85
Fly 86 DPQK---KAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLEDQEYV 147
Fly 148 A------------------------GDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKE 188
Fly 189 VTPGW 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 41/193 (21%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 11/52 (21%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 27/132 (20%) | ||
clic4 | NP_958894.1 | GST_N_CLIC | 13..103 | CDD:239359 | 16/65 (25%) |
O-ClC | 16..250 | CDD:129941 | 43/199 (22%) | ||
GST_C_CLIC4 | 110..250 | CDD:198329 | 26/126 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589431 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |