DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstE14

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:209 Identity:66/209 - (31%)
Similarity:121/209 - (57%) Gaps:8/209 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            ||...|.|.||.:|..|.|.:|:.::.:.:..|||.:.:|:.|||||.:||||.....:.:|.||
  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAI 73

  Fly    69 LIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQ---SFVEAIYPQ-IRNNHPADPEAMQK 129
            ||:|.||:....||:|.:..::..|...|.|:...||:   .|:.|...| ..|...|..|  :|
  Fly    74 LIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHE--RK 136

  Fly   130 VDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWE 194
            :..|:..::.:||:.:::||..||:||::::.::||..:: |.::|:|.:.||: .|.:....:|
  Fly   137 LTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWF-TAMQQLDAYE 199

  Fly   195 ENWDGVQLIKKLVQ 208
            .|..|::.:::.::
  Fly   200 ANCSGLEKLRQTME 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 63/187 (34%)
GST_N_Delta_Epsilon 1..74 CDD:239343 29/69 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/119 (27%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 63/194 (32%)
GST_N_Delta_Epsilon 6..79 CDD:239343 29/69 (42%)
GST_C_Delta_Epsilon 94..209 CDD:198287 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.