DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and mars1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio


Alignment Length:217 Identity:42/217 - (19%)
Similarity:79/217 - (36%) Gaps:44/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTL-VDDGFSIWESRAILIYLVEK 75
            |..|:...:..||....:|:|  ..|::.|...  :|  .:|.| :..|..::...:|..||.:.
Zfish    12 CLKVLAALELSGVRCETQLVK--HEEKVVPYLT--HP--VLPILQLPSGQHLFSPNSICQYLFDV 70

  Fly    76 YGADDSLYPSDPQKKA-VVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDT 139
            .|          ||.. ..||.|.::...|..:.::::..........:..|:.|...::.....
Zfish    71 SG----------QKATDATNQWLEWEATNLQPAVLQSLQLVALQGKRVEAAAVMKEPLSWLEQSL 125

  Fly   140 FLEDQEYVAGDCLTIADIAL------LASVSTFEVVDFDIAQYPNVARWYEN----------AKE 188
            ......::..:.:::||:.|      |.|.|.||..|...     |..|:|.          |..
Zfish   126 SKRKTSFLTDEVVSVADVVLWAALYPLLSDSAFEPGDLQA-----VRGWFERVCSVSACQSAALR 185

  Fly   189 VTPGWEENWDGVQLIKKLVQER 210
            |..|     .|.:.:|..:|::
Zfish   186 VLQG-----KGAEALKSFLQKQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 37/193 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/132 (18%)
mars1NP_956370.1 GstA 1..173 CDD:223698 36/181 (20%)
GST_N_family 1..67 CDD:238319 13/60 (22%)
GST_C_MetRS_N 75..176 CDD:198340 18/105 (17%)
PRK12268 261..820 CDD:237029
MetRS_core 263..631 CDD:173907
Anticodon_Ia_Met 640..769 CDD:153411
MetRS_RNA 866..910 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.